USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
English
Germany GermanyFrance FranceSpain SpainPortugal Portugal
0 items
New Products
Product Details
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
The Rooikat Cub Take-down Recurve Bow
Product Code:N0ThS7e
Product Condition:New
$495.00 inc. tax
Add to Cart
Description
This smaller version of the popular Rooikat design is perfect for teens and or people of smaller stature.

Customize it with your choice of riser timbers and available in 20# to 50# and add veneers to the limbs to truly make it your dream bow.

We will contact you to customize your bow once we received your order.
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i