USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
English
Germany GermanyFrance FranceSpain SpainPortugal Portugal
0 items
New Products
Product Details
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
The "Rooikat" - Caracal take-down Recurve bow
Brand:EBC bows Recurve bows
Product Code:Rooikat MK1
Product Condition:New
$495.00 inc. tax
Add to Cart
Description
Stealthy and fast like the African "Rooikat" (Red cat) it is named for, this  60" Take-down recurve bow is a pleasure to shoot .

The Beautiful Panga panga, Walnut and Ash riser, with its simple lines and Crystal clear fibreglass and Bamboo limbs makes this bow a perfect combination of beauty and performance.

Your choice of Riser timbers and veneers combined with the poundage of your choice customizes your bow to the bow of your dreams.

We will contact you to customize your bow, when we receive your order.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i